PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa012115
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 297aa    MW: 32195.8 Da    PI: 9.4076
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58684651PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.7e-3970130262
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                +e a+kcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nkkss
  Lsa012115  70 PEMAMKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKKSS 130
                67789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3059123IPR003851Zinc finger, Dof-type
PfamPF027017.3E-3373128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.40474128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MVFSSLPSYL DPSNWHQQQP AGGVGVGGDH EISHQLPPSL LPPPQPLGSS GDGRSLQTSE  60
RGRMAKLPQP EMAMKCPRCE STNTKFCYFN NYSLSQPRHF CKTCRRYWTR GGALRNVPVG  120
GGCRRNKKSS KASRGSRSKS PTATTSSTSN TPISPNYSCT TDILGHNTRP SQFPILPPLH  180
HYTGGDLGLT FGVGNGTDLI NLGHDSNYPT SKFARFPFLE AANGGMYGEG PSNYSGQVGG  240
MKMDENHHQQ EQHQALNLSR NFLGISGNEQ FMSTSNVAWG TTHLSGFTSS STTTTHI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436002.19e-75hypothetical protein CICLE_v10032039mg
RefseqXP_006486095.19e-75PREDICTED: dof zinc finger protein DOF3.6
TrEMBLA0A124SG071e-139A0A124SG07_CYNCS; Zinc finger, Dof-type
STRINGPOPTR_0010s21240.12e-63(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-40OBF-binding protein 3